CD300A,CMRF-35-H9
  • CD300A,CMRF-35-H9

Anti-CD300A Antibody 100ul

Ref: AN-HPA011645-100ul
Anti-CD300A

Información del producto

Polyclonal Antibody against Human CD300A, Gene description: CD300a molecule, Alternative Gene Names: CMRF-35-H9, CMRF35H, IGSF12, IRC1, IRC2, Irp60, Validated applications: IHC, Uniprot ID: Q9UGN4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CD300A
Gene Description CD300a molecule
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK
Immunogen SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CMRF-35-H9, CMRF35H, IGSF12, IRC1, IRC2, Irp60
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UGN4
HTS Code 3002150000
Gene ID 11314
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CD300A Antibody 100ul

Anti-CD300A Antibody 100ul