SAP18,2HOR0202
  • SAP18,2HOR0202

Anti-SAP18 Antibody 25ul

Ref: AN-HPA011352-25ul
Anti-SAP18

Información del producto

Polyclonal Antibody against Human SAP18, Gene description: Sin3A-associated protein, 18kDa, Alternative Gene Names: 2HOR0202, MGC27131, SAP18p, Validated applications: ICC, IHC, Uniprot ID: O00422, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SAP18
Gene Description Sin3A-associated protein, 18kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence VTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPP
Immunogen VTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 2HOR0202, MGC27131, SAP18p
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00422
HTS Code 3002150000
Gene ID 10284
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SAP18 Antibody 25ul

Anti-SAP18 Antibody 25ul