IGF2R,CD222,CIMPR
  • IGF2R,CD222,CIMPR

Anti-IGF2R Antibody 100ul

Ref: AN-HPA011332-100ul
Anti-IGF2R

Información del producto

Polyclonal Antibody against Human IGF2R, Gene description: insulin-like growth factor 2 receptor, Alternative Gene Names: CD222, CIMPR, M6P-R, MPR1, MPRI, Validated applications: ICC, IHC, Uniprot ID: P11717, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IGF2R
Gene Description insulin-like growth factor 2 receptor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence CKKDIFKANKEVPCYVFDEELRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRDPGSQLRACPPGTAACLVRGHQAFDVGQPRDGLKLVRKDRLVLSYVREEAGKLDFCDGHSPAVTITFVCPSE
Immunogen CKKDIFKANKEVPCYVFDEELRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRDPGSQLRACPPGTAACLVRGHQAFDVGQPRDGLKLVRKDRLVLSYVREEAGKLDFCDGHSPAVTITFVCPSE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD222, CIMPR, M6P-R, MPR1, MPRI
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P11717
HTS Code 3002150000
Gene ID 3482
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IGF2R Antibody 100ul

Anti-IGF2R Antibody 100ul