FMR1NB,CT37
  • FMR1NB,CT37

Anti-FMR1NB Antibody 100ul

Ref: AN-HPA011284-100ul
Anti-FMR1NB

Información del producto

Polyclonal Antibody against Human FMR1NB, Gene description: fragile X mental retardation 1 neighbor, Alternative Gene Names: CT37, FLJ25736, NY-SAR-35, Validated applications: IHC, WB, Uniprot ID: Q8N0W7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FMR1NB
Gene Description fragile X mental retardation 1 neighbor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence VLANGHILPNSENAHGQSLEEDSALEALLNFFFPTTCNLRENQVAKPCNELQDLSESECLRHKCCFSSSGTTSFKCFAPFRDVPKQMMQM
Immunogen VLANGHILPNSENAHGQSLEEDSALEALLNFFFPTTCNLRENQVAKPCNELQDLSESECLRHKCCFSSSGTTSFKCFAPFRDVPKQMMQM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT37, FLJ25736, NY-SAR-35
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N0W7
HTS Code 3002150000
Gene ID 158521
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FMR1NB Antibody 100ul

Anti-FMR1NB Antibody 100ul