GALNTL5,GalNAc-T5L
  • GALNTL5,GalNAc-T5L

Anti-GALNTL5 Antibody 25ul

Ref: AN-HPA011140-25ul
Anti-GALNTL5

Información del producto

Polyclonal Antibody against Human GALNTL5, Gene description: polypeptide N-acetylgalactosaminyltransferase-like 5, Alternative Gene Names: GalNAc-T5L, GALNT15, Validated applications: IHC, WB, Uniprot ID: Q7Z4T8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GALNTL5
Gene Description polypeptide N-acetylgalactosaminyltransferase-like 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence HCEVNRVWLEPLLHAIAKDPKMVVCPLIDVIDDRTLEYKPSPLVRGTFDWNLQFKWDNVFSYEMDGPEGSTKPIRSPAMSGGIFAIRRHYFNEIGQYDKDMD
Immunogen HCEVNRVWLEPLLHAIAKDPKMVVCPLIDVIDDRTLEYKPSPLVRGTFDWNLQFKWDNVFSYEMDGPEGSTKPIRSPAMSGGIFAIRRHYFNEIGQYDKDMD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GalNAc-T5L, GALNT15
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z4T8
HTS Code 3002150000
Gene ID 168391
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GALNTL5 Antibody 25ul

Anti-GALNTL5 Antibody 25ul