HLA-DPB1,HLA-DP1B
  • HLA-DPB1,HLA-DP1B

Anti-HLA-DPB1 Antibody 25ul

Ref: AN-HPA011078-25ul
Anti-HLA-DPB1

Información del producto

Polyclonal Antibody against Human HLA-DPB1, Gene description: major histocompatibility complex, class II, DP beta 1, Alternative Gene Names: HLA-DP1B, Validated applications: IHC, WB, Uniprot ID: P04440, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HLA-DPB1
Gene Description major histocompatibility complex, class II, DP beta 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence YNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTF
Immunogen YNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HLA-DP1B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P04440
HTS Code 3002150000
Gene ID 3115
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HLA-DPB1 Antibody 25ul

Anti-HLA-DPB1 Antibody 25ul