NECTIN3,CD113
  • NECTIN3,CD113

Anti-NECTIN3 Antibody 100ul

Ref: AN-HPA011038-100ul
Anti-NECTIN3

Información del producto

Polyclonal Antibody against Human NECTIN3, Gene description: nectin cell adhesion molecule 3, Alternative Gene Names: CD113, CDw113, DKFZP566B0846, nectin-3, PPR3, PVRL3, PVRR3, Validated applications: ICC, IHC, Uniprot ID: Q9NQS3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NECTIN3
Gene Description nectin cell adhesion molecule 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence IHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAICIAATGKPVAHIDWEGDLGEMESTTTSF
Immunogen IHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAICIAATGKPVAHIDWEGDLGEMESTTTSF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD113, CDw113, DKFZP566B0846, nectin-3, PPR3, PVRL3, PVRR3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NQS3
HTS Code 3002150000
Gene ID 25945
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NECTIN3 Antibody 100ul

Anti-NECTIN3 Antibody 100ul