DPYSL3,CRMP4,DRP-3
  • DPYSL3,CRMP4,DRP-3

Anti-DPYSL3 Antibody 100ul

Ref: AN-HPA010948-100ul
Anti-DPYSL3

Información del producto

Polyclonal Antibody against Human DPYSL3, Gene description: dihydropyrimidinase-like 3, Alternative Gene Names: CRMP4, DRP-3, ULIP, Validated applications: ICC, IHC, WB, Uniprot ID: Q14195, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DPYSL3
Gene Description dihydropyrimidinase-like 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence IIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQTRMLEMGITGPE
Immunogen IIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQTRMLEMGITGPE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CRMP4, DRP-3, ULIP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14195
HTS Code 3002150000
Gene ID 1809
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DPYSL3 Antibody 100ul

Anti-DPYSL3 Antibody 100ul