AGPAT5,FLJ11210
  • AGPAT5,FLJ11210

Anti-AGPAT5 Antibody 100ul

Ref: AN-HPA010644-100ul
Anti-AGPAT5

Información del producto

Polyclonal Antibody against Human AGPAT5, Gene description: 1-acylglycerol-3-phosphate O-acyltransferase 5, Alternative Gene Names: FLJ11210, LPAAT-e, LPAAT-epsilon, Validated applications: IHC, WB, Uniprot ID: Q9NUQ2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name AGPAT5
Gene Description 1-acylglycerol-3-phosphate O-acyltransferase 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence VAFDCMKNYLDAIYDVTVVYEGKDDGGQRRESPTMTEFLCKECPKIHIHIDRIDKKDVPEEQEHMRRWLHERFEIKDKMLIEFYESPDPERRKRFPGKSVNSKLSIKKTLPSMLILSGLTAGMLMTDAGRKLY
Immunogen VAFDCMKNYLDAIYDVTVVYEGKDDGGQRRESPTMTEFLCKECPKIHIHIDRIDKKDVPEEQEHMRRWLHERFEIKDKMLIEFYESPDPERRKRFPGKSVNSKLSIKKTLPSMLILSGLTAGMLMTDAGRKLY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ11210, LPAAT-e, LPAAT-epsilon
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NUQ2
HTS Code 3002150000
Gene ID 55326
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-AGPAT5 Antibody 100ul

Anti-AGPAT5 Antibody 100ul