HILPDA,C7orf68
  • HILPDA,C7orf68

Anti-HILPDA Antibody 100ul

Ref: AN-HPA010515-100ul
Anti-HILPDA

Información del producto

Polyclonal Antibody against Human HILPDA, Gene description: hypoxia inducible lipid droplet-associated, Alternative Gene Names: C7orf68, FLJ21076, HIG-2, HIG2, Validated applications: ICC, Uniprot ID: Q9Y5L2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HILPDA
Gene Description hypoxia inducible lipid droplet-associated
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM
Immunogen LEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C7orf68, FLJ21076, HIG-2, HIG2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y5L2
HTS Code 3002150000
Gene ID 29923
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HILPDA Antibody 100ul

Anti-HILPDA Antibody 100ul