DLG4,PSD-95,PSD95
  • DLG4,PSD-95,PSD95

Anti-DLG4 Antibody 100ul

Ref: AN-HPA010122-100ul
Anti-DLG4

Información del producto

Polyclonal Antibody against Human DLG4, Gene description: discs, large homolog 4 (Drosophila), Alternative Gene Names: PSD-95, PSD95, SAP-90, SAP90, Validated applications: IHC, Uniprot ID: P78352, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DLG4
Gene Description discs, large homolog 4 (Drosophila)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence HDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYAR
Immunogen HDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYAR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PSD-95, PSD95, SAP-90, SAP90
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P78352
HTS Code 3002150000
Gene ID 1742
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DLG4 Antibody 100ul

Anti-DLG4 Antibody 100ul