RPS6KB2,KLS
  • RPS6KB2,KLS

Anti-RPS6KB2 Antibody 25ul

Ref: AN-HPA010010-25ul
Anti-RPS6KB2

Información del producto

Polyclonal Antibody against Human RPS6KB2, Gene description: ribosomal protein S6 kinase, 70kDa, polypeptide 2, Alternative Gene Names: KLS, P70-BETA, p70S6Kb, STK14B, Validated applications: IHC, WB, Uniprot ID: Q9UBS0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RPS6KB2
Gene Description ribosomal protein S6 kinase, 70kDa, polypeptide 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence VDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKK
Immunogen VDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KLS, P70-BETA, p70S6Kb, STK14B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UBS0
HTS Code 3002150000
Gene ID 6199
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RPS6KB2 Antibody 25ul

Anti-RPS6KB2 Antibody 25ul