PIP,GCDFP-15
  • PIP,GCDFP-15

Anti-PIP Antibody 25ul

Ref: AN-HPA009177-25ul
Anti-PIP

Información del producto

Polyclonal Antibody against Human PIP, Gene description: prolactin-induced protein, Alternative Gene Names: GCDFP-15, GCDFP15, GPIP4, Validated applications: IHC, WB, Uniprot ID: P12273, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PIP
Gene Description prolactin-induced protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence FDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
Immunogen FDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GCDFP-15, GCDFP15, GPIP4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P12273
HTS Code 3002150000
Gene ID 5304
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PIP Antibody 25ul

Anti-PIP Antibody 25ul