VAPA,hVAP-33,VAP-A
  • VAPA,hVAP-33,VAP-A

Anti-VAPA Antibody 25ul

Ref: AN-HPA009174-25ul
Anti-VAPA

Información del producto

Polyclonal Antibody against Human VAPA, Gene description: VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa, Alternative Gene Names: hVAP-33, VAP-A, Validated applications: ICC, IHC, WB, Uniprot ID: Q9P0L0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name VAPA
Gene Description VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence NDKLGITPPGNAPTVTSMSSINNTVATPASYHTKDDPRGLSVLKQEKQKNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASF
Immunogen NDKLGITPPGNAPTVTSMSSINNTVATPASYHTKDDPRGLSVLKQEKQKNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hVAP-33, VAP-A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P0L0
HTS Code 3002150000
Gene ID 9218
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-VAPA Antibody 25ul

Anti-VAPA Antibody 25ul