SLC1A2,EAAT2,GLT-1
  • SLC1A2,EAAT2,GLT-1

Anti-SLC1A2 Antibody 25ul

Ref: AN-HPA009172-25ul
Anti-SLC1A2

Información del producto

Polyclonal Antibody against Human SLC1A2, Gene description: solute carrier family 1 (glial high affinity glutamate transporter), member 2, Alternative Gene Names: EAAT2, GLT-1, Validated applications: IHC, Uniprot ID: P43004, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SLC1A2
Gene Description solute carrier family 1 (glial high affinity glutamate transporter), member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNV
Immunogen SLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EAAT2, GLT-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P43004
HTS Code 3002150000
Gene ID 6506
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC1A2 Antibody 25ul

Anti-SLC1A2 Antibody 25ul