SIGLEC5,CD170
  • SIGLEC5,CD170

Anti-SIGLEC5 Antibody 100ul

Ref: AN-HPA009085-100ul
Anti-SIGLEC5

Información del producto

Polyclonal Antibody against Human SIGLEC5, Gene description: sialic acid binding Ig-like lectin 5, Alternative Gene Names: CD170, CD33L2, OB-BP2, SIGLEC-5, Validated applications: IHC, Uniprot ID: O15389, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SIGLEC5
Gene Description sialic acid binding Ig-like lectin 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KARRKQAAGRPEKMDDEDPIMGTITSGSRKKPWPDSAGDQASPPGDAPPLEEQKELHYASLSFSEMKSREPKDQEAPSTTEYSEIKTSK
Immunogen KARRKQAAGRPEKMDDEDPIMGTITSGSRKKPWPDSAGDQASPPGDAPPLEEQKELHYASLSFSEMKSREPKDQEAPSTTEYSEIKTSK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD170, CD33L2, OB-BP2, SIGLEC-5
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15389
HTS Code 3002150000
Gene ID 8778
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SIGLEC5 Antibody 100ul

Anti-SIGLEC5 Antibody 100ul