ICAM5,TLCN,TLN
  • ICAM5,TLCN,TLN

Anti-ICAM5 Antibody 25ul

Ref: AN-HPA009083-25ul
Anti-ICAM5

Información del producto

Polyclonal Antibody against Human ICAM5, Gene description: intercellular adhesion molecule 5, telencephalin, Alternative Gene Names: TLCN, TLN, Validated applications: IHC, Uniprot ID: Q9UMF0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ICAM5
Gene Description intercellular adhesion molecule 5, telencephalin
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PPEMDESTCPSHQTWLEGAEASALACAARGRPSPGVRCSREGIPWPEQQRVSREDAGTYHCVATNAHGTDSRTVTVGVEYRPVVAELAASPPGGVRPGGNFTLTCR
Immunogen PPEMDESTCPSHQTWLEGAEASALACAARGRPSPGVRCSREGIPWPEQQRVSREDAGTYHCVATNAHGTDSRTVTVGVEYRPVVAELAASPPGGVRPGGNFTLTCR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TLCN, TLN
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UMF0
HTS Code 3002150000
Gene ID 7087
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ICAM5 Antibody 25ul

Anti-ICAM5 Antibody 25ul