ZNF134,pHZ-15
  • ZNF134,pHZ-15

Anti-ZNF134 Antibody 25ul

Ref: AN-HPA009064-25ul
Anti-ZNF134

Información del producto

Polyclonal Antibody against Human ZNF134, Gene description: zinc finger protein 134, Alternative Gene Names: pHZ-15, Validated applications: ICC, IHC, Uniprot ID: P52741, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZNF134
Gene Description zinc finger protein 134
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence DCGKVFRHKSTLVQHESIHTGENPYDCSDCGKSFGHKYTLIKHQRIHTESKPFECIECGKFFSRSSDYIAHQRVHTGERPFVCSKCGKDFIRTSHLVRHQRVHTGERPYECSECGKAYSLSSHLNRHQK
Immunogen DCGKVFRHKSTLVQHESIHTGENPYDCSDCGKSFGHKYTLIKHQRIHTESKPFECIECGKFFSRSSDYIAHQRVHTGERPFVCSKCGKDFIRTSHLVRHQRVHTGERPYECSECGKAYSLSSHLNRHQK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names pHZ-15
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P52741
HTS Code 3002150000
Gene ID 7693
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZNF134 Antibody 25ul

Anti-ZNF134 Antibody 25ul