B4GALNT1
  • B4GALNT1

Anti-B4GALNT1 Antibody 25ul

Ref: AN-HPA008968-25ul
Anti-B4GALNT1

Información del producto

Polyclonal Antibody against Human B4GALNT1, Gene description: beta-1,4-N-acetyl-galactosaminyl transferase 1, Alternative Gene Names: beta1-4GalNAc-T, GALGT, SPG26, Validated applications: IHC, WB, Uniprot ID: Q00973, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name B4GALNT1
Gene Description beta-1,4-N-acetyl-galactosaminyl transferase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence LAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQE
Immunogen LAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names beta1-4GalNAc-T, GALGT, SPG26
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q00973
HTS Code 3002150000
Gene ID 2583
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-B4GALNT1 Antibody 25ul

Anti-B4GALNT1 Antibody 25ul