GALNT5,GalNAc-T5
  • GALNT5,GalNAc-T5

Anti-GALNT5 Antibody 25ul

Ref: AN-HPA008963-25ul
Anti-GALNT5

Información del producto

Polyclonal Antibody against Human GALNT5, Gene description: polypeptide N-acetylgalactosaminyltransferase 5, Alternative Gene Names: GalNAc-T5, Validated applications: ICC, IHC, Uniprot ID: Q7Z7M9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GALNT5
Gene Description polypeptide N-acetylgalactosaminyltransferase 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence AERDLNVTISLSTDRPKQRSQAVANERAHPASTAVPKSGEAMALNKTKTQSKEVNANKHKANTSLPFPKFTVNSNRLRKQSINETPLGSLSKDDGARGAHGKKLNFSESHLVIITKEEEQKADPKEVSNSKTKTIFPKVLGKS
Immunogen AERDLNVTISLSTDRPKQRSQAVANERAHPASTAVPKSGEAMALNKTKTQSKEVNANKHKANTSLPFPKFTVNSNRLRKQSINETPLGSLSKDDGARGAHGKKLNFSESHLVIITKEEEQKADPKEVSNSKTKTIFPKVLGKS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GalNAc-T5
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z7M9
HTS Code 3002150000
Gene ID 11227
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GALNT5 Antibody 25ul

Anti-GALNT5 Antibody 25ul