ADAM7,EAPI,GP-83
  • ADAM7,EAPI,GP-83

Anti-ADAM7 Antibody 25ul

Ref: AN-HPA008879-25ul
Anti-ADAM7

Información del producto

Polyclonal Antibody against Human ADAM7, Gene description: ADAM metallopeptidase domain 7, Alternative Gene Names: EAPI, GP-83, Validated applications: IHC, Uniprot ID: Q9H2U9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ADAM7
Gene Description ADAM metallopeptidase domain 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LGVEGQQLVRPKKLPLIQKRDTGHTHDDDILKTYEEELLYEIKLNRKTLVLHLLRSREFLGSNYSETFYSMKGEAFTRHPQIMDHCFYQGSIVHEYDSAASISTCNGLRGFFRINDQRYLIEPVKYSDEGEHLVFKYNLRVPYGANYS
Immunogen LGVEGQQLVRPKKLPLIQKRDTGHTHDDDILKTYEEELLYEIKLNRKTLVLHLLRSREFLGSNYSETFYSMKGEAFTRHPQIMDHCFYQGSIVHEYDSAASISTCNGLRGFFRINDQRYLIEPVKYSDEGEHLVFKYNLRVPYGANYS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EAPI, GP-83
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H2U9
HTS Code 3002150000
Gene ID 8756
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ADAM7 Antibody 25ul

Anti-ADAM7 Antibody 25ul