LONP2,LONP,LONPL
  • LONP2,LONP,LONPL

Anti-LONP2 Antibody 100ul

Ref: AN-HPA008862-100ul
Anti-LONP2

Información del producto

Polyclonal Antibody against Human LONP2, Gene description: lon peptidase 2, peroxisomal, Alternative Gene Names: LONP, LONPL, MGC4840, Validated applications: IHC, WB, Uniprot ID: Q86WA8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LONP2
Gene Description lon peptidase 2, peroxisomal
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence TILGVIPNTPDPASDAQDLPPLHRIGTAALAVQVVGSNWPKPHYTLLITGLCRFQIVQVLKEKPYPIAEVEQLDRLEEFPNTCKMREELGELSEQFYKYAVQLVEMLDMSVPAVAKLRR
Immunogen TILGVIPNTPDPASDAQDLPPLHRIGTAALAVQVVGSNWPKPHYTLLITGLCRFQIVQVLKEKPYPIAEVEQLDRLEEFPNTCKMREELGELSEQFYKYAVQLVEMLDMSVPAVAKLRR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LONP, LONPL, MGC4840
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86WA8
HTS Code 3002150000
Gene ID 83752
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LONP2 Antibody 100ul

Anti-LONP2 Antibody 100ul