PFDN5,MM-1,PFD5
  • PFDN5,MM-1,PFD5

Anti-PFDN5 Antibody 100ul

Ref: AN-HPA008587-100ul
Anti-PFDN5

Información del producto

Polyclonal Antibody against Human PFDN5, Gene description: prefoldin subunit 5, Alternative Gene Names: MM-1, PFD5, Validated applications: IHC, WB, Uniprot ID: Q99471, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PFDN5
Gene Description prefoldin subunit 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence INITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTA
Immunogen INITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MM-1, PFD5
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99471
HTS Code 3002150000
Gene ID 5204
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PFDN5 Antibody 100ul

Anti-PFDN5 Antibody 100ul