ITGA3,CD49c,GAP-B3
  • ITGA3,CD49c,GAP-B3

Anti-ITGA3 Antibody 100ul

Ref: AN-HPA008572-100ul
Anti-ITGA3

Información del producto

Polyclonal Antibody against Human ITGA3, Gene description: integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor), Alternative Gene Names: CD49c, GAP-B3, MSK18, VCA-2, VLA3a, Validated applications: IHC, WB, Uniprot ID: P26006, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ITGA3
Gene Description integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Rat
Applications IHC, WB
Sequence AQALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEVIGV
Immunogen AQALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEVIGV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD49c, GAP-B3, MSK18, VCA-2, VLA3a
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P26006
HTS Code 3002150000
Gene ID 3675
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ITGA3 Antibody 100ul

Anti-ITGA3 Antibody 100ul