TAF12,TAF2J,TAFII20
  • TAF12,TAF2J,TAFII20

Anti-TAF12 Antibody 100ul

Ref: AN-HPA008519-100ul
Anti-TAF12

Información del producto

Polyclonal Antibody against Human TAF12, Gene description: TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa, Alternative Gene Names: TAF2J, TAFII20, Validated applications: IHC, Uniprot ID: Q16514, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TAF12
Gene Description TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence NLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIR
Immunogen NLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TAF2J, TAFII20
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q16514
HTS Code 3002150000
Gene ID 6883
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TAF12 Antibody 100ul

Anti-TAF12 Antibody 100ul