LRRC47,KIAA1185
  • LRRC47,KIAA1185

Anti-LRRC47 Antibody 100ul

Ref: AN-HPA008512-100ul
Anti-LRRC47

Información del producto

Polyclonal Antibody against Human LRRC47, Gene description: leucine rich repeat containing 47, Alternative Gene Names: KIAA1185, RP1-286D6.3, Validated applications: ICC, IHC, WB, Uniprot ID: Q8N1G4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LRRC47
Gene Description leucine rich repeat containing 47
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence PGNALKRFLTSQTKLHEDLCEKRTAATLATHELRAVKGPLLYCARPPQDLKIVPLGRKEAKAKELVRQLQLEAEEQRKQKKRQSVSGLHRYLHLLDGNENYPCLVDADGDVISFPPITNSEK
Immunogen PGNALKRFLTSQTKLHEDLCEKRTAATLATHELRAVKGPLLYCARPPQDLKIVPLGRKEAKAKELVRQLQLEAEEQRKQKKRQSVSGLHRYLHLLDGNENYPCLVDADGDVISFPPITNSEK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1185, RP1-286D6.3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N1G4
HTS Code 3002150000
Gene ID 57470
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LRRC47 Antibody 100ul

Anti-LRRC47 Antibody 100ul