C1orf174
  • C1orf174

Anti-C1orf174 Antibody 100ul

Ref: AN-HPA008270-100ul
Anti-C1orf174

Información del producto

Polyclonal Antibody against Human C1orf174, Gene description: chromosome 1 open reading frame 174, Alternative Gene Names: RP13-531C17.2, Validated applications: ICC, IHC, Uniprot ID: Q8IYL3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C1orf174
Gene Description chromosome 1 open reading frame 174
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence VSDSRLAKTRDGLSVPKHSAGSGAEESNSSSTVQKQNEPGLQTEDVQKPPLQMDNSVFLDDDSNQPMPVSRFFGNVELMQDLPPASSSCPSMSRREFRKMHFRAKDDDDDDDDD
Immunogen VSDSRLAKTRDGLSVPKHSAGSGAEESNSSSTVQKQNEPGLQTEDVQKPPLQMDNSVFLDDDSNQPMPVSRFFGNVELMQDLPPASSSCPSMSRREFRKMHFRAKDDDDDDDDD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names RP13-531C17.2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IYL3
HTS Code 3002150000
Gene ID 339448
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C1orf174 Antibody 100ul

Anti-C1orf174 Antibody 100ul