PLGRKT,AD025
  • PLGRKT,AD025

Anti-PLGRKT Antibody 25ul

Ref: AN-HPA008214-25ul
Anti-PLGRKT

Información del producto

Polyclonal Antibody against Human PLGRKT, Gene description: plasminogen receptor, C-terminal lysine transmembrane protein, Alternative Gene Names: AD025, C9orf46, FLJ14688, MDS030, Plg-RKT, Validated applications: IHC, WB, Uniprot ID: Q9HBL7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PLGRKT
Gene Description plasminogen receptor, C-terminal lysine transmembrane protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence QKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSRE
Immunogen QKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSRE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AD025, C9orf46, FLJ14688, MDS030, Plg-RKT
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HBL7
HTS Code 3002150000
Gene ID 55848
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PLGRKT Antibody 25ul

Anti-PLGRKT Antibody 25ul