STXBP1,hUNC18
  • STXBP1,hUNC18

Anti-STXBP1 Antibody 100ul

Ref: AN-HPA008209-100ul
Anti-STXBP1

Información del producto

Polyclonal Antibody against Human STXBP1, Gene description: syntaxin binding protein 1, Alternative Gene Names: hUNC18, MUNC18-1, rbSec1, UNC18, Validated applications: ICC, IHC, WB, Uniprot ID: P61764, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name STXBP1
Gene Description syntaxin binding protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence TDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPT
Immunogen TDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hUNC18, MUNC18-1, rbSec1, UNC18
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P61764
HTS Code 3002150000
Gene ID 6812
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-STXBP1 Antibody 100ul

Anti-STXBP1 Antibody 100ul