TSKU,E2IG4,LRRC54
  • TSKU,E2IG4,LRRC54

Anti-TSKU Antibody 100ul

Ref: AN-HPA008164-100ul
Anti-TSKU

Información del producto

Polyclonal Antibody against Human TSKU, Gene description: tsukushi, small leucine rich proteoglycan, Alternative Gene Names: E2IG4, LRRC54, TSK, Validated applications: ICC, IHC, WB, Uniprot ID: Q8WUA8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TSKU
Gene Description tsukushi, small leucine rich proteoglycan
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence DTAHLDLSSNRLEMVNESVLAGPGYTTLAGLDLSHNLLTSISPTAFSRLRYLESLDLSHNGLTALPAESFTSSPLSDVNLSHNQLREVSVSAFTTHSQGRALHVDLSHNLIHR
Immunogen DTAHLDLSSNRLEMVNESVLAGPGYTTLAGLDLSHNLLTSISPTAFSRLRYLESLDLSHNGLTALPAESFTSSPLSDVNLSHNQLREVSVSAFTTHSQGRALHVDLSHNLIHR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names E2IG4, LRRC54, TSK
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WUA8
HTS Code 3002150000
Gene ID 25987
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TSKU Antibody 100ul

Anti-TSKU Antibody 100ul