LAMB3,BM600-125kDa
  • LAMB3,BM600-125kDa

Anti-LAMB3 Antibody 100ul

Ref: AN-HPA008069-100ul
Anti-LAMB3

Información del producto

Polyclonal Antibody against Human LAMB3, Gene description: laminin, beta 3, Alternative Gene Names: BM600-125kDa, kalinin-140kDa, LAMNB1, nicein-125kDa, Validated applications: IHC, WB, Uniprot ID: Q13751, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LAMB3
Gene Description laminin, beta 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence KLVTSMTKQLGDFWTRMEELRHQARQQGAEAVQAQQLAEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQ
Immunogen KLVTSMTKQLGDFWTRMEELRHQARQQGAEAVQAQQLAEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BM600-125kDa, kalinin-140kDa, LAMNB1, nicein-125kDa
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13751
HTS Code 3002150000
Gene ID 3914
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LAMB3 Antibody 100ul

Anti-LAMB3 Antibody 100ul