FKBP15,FKBP133
  • FKBP15,FKBP133

Anti-FKBP15 Antibody 25ul

Ref: AN-HPA007979-25ul
Anti-FKBP15

Información del producto

Polyclonal Antibody against Human FKBP15, Gene description: FK506 binding protein 15, 133kDa, Alternative Gene Names: FKBP133, KIAA0674, PPP1R76, WAFL, Validated applications: IHC, WB, Uniprot ID: Q5T1M5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FKBP15
Gene Description FK506 binding protein 15, 133kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence KHSAGNSMLIPSMSVTMETSMIMSNIQRIIQENERLKQEILEKSNRIEEQNDKISELIERNQRYVEQSNLMMEKRNNSLQTATENTQARVLHAEQEKAKVTEELAAATAQVSHLQLKMTAHQ
Immunogen KHSAGNSMLIPSMSVTMETSMIMSNIQRIIQENERLKQEILEKSNRIEEQNDKISELIERNQRYVEQSNLMMEKRNNSLQTATENTQARVLHAEQEKAKVTEELAAATAQVSHLQLKMTAHQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FKBP133, KIAA0674, PPP1R76, WAFL
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T1M5
HTS Code 3002150000
Gene ID 23307
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FKBP15 Antibody 25ul

Anti-FKBP15 Antibody 25ul