IL1RL1,DER4,FIT-1
  • IL1RL1,DER4,FIT-1

Anti-IL1RL1 Antibody 25ul

Ref: AN-HPA007917-25ul
Anti-IL1RL1

Información del producto

Polyclonal Antibody against Human IL1RL1, Gene description: interleukin 1 receptor-like 1, Alternative Gene Names: DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1, Validated applications: ICC, IHC, Uniprot ID: Q01638, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IL1RL1
Gene Description interleukin 1 receptor-like 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence PSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRY
Immunogen PSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q01638
HTS Code 3002150000
Gene ID 9173
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IL1RL1 Antibody 25ul

Anti-IL1RL1 Antibody 25ul