AGR2,AG2,HAG-2
  • AGR2,AG2,HAG-2

Anti-AGR2 Antibody 100ul

Ref: AN-HPA007912-100ul
Anti-AGR2

Información del producto

Polyclonal Antibody against Human AGR2, Gene description: anterior gradient 2, Alternative Gene Names: AG2, HAG-2, PDIA17, XAG-2, Validated applications: ICC, IHC, WB, Uniprot ID: O95994, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name AGR2
Gene Description anterior gradient 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGR
Immunogen RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AG2, HAG-2, PDIA17, XAG-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95994
HTS Code 3002150000
Gene ID 10551
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-AGR2 Antibody 100ul

Anti-AGR2 Antibody 100ul