P4HA3
  • P4HA3

Anti-P4HA3 Antibody 25ul

Ref: AN-HPA007897-25ul
Anti-P4HA3

Información del producto

Polyclonal Antibody against Human P4HA3, Gene description: prolyl 4-hydroxylase, alpha polypeptide III, Alternative Gene Names: C-P4Halpha(III), Validated applications: IHC, Uniprot ID: Q7Z4N8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name P4HA3
Gene Description prolyl 4-hydroxylase, alpha polypeptide III
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TTPVANPLLAFTLIKRLQSDWRNVVHSLEASENIRALKDGYEKVEQDLPAFEDLEGAARALMRLQDVYMLNVKGLARGVFQRVTGSAITDLYSPKRLFSLTGDDCFQVGKV
Immunogen TTPVANPLLAFTLIKRLQSDWRNVVHSLEASENIRALKDGYEKVEQDLPAFEDLEGAARALMRLQDVYMLNVKGLARGVFQRVTGSAITDLYSPKRLFSLTGDDCFQVGKV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C-P4Halpha(III)
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z4N8
HTS Code 3002150000
Gene ID 283208
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-P4HA3 Antibody 25ul

Anti-P4HA3 Antibody 25ul