Ver mas grande
Anti-FNDC3B Antibody 25ul
AN-HPA007859-25ul
Producto nuevo
Anti-FNDC3B
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 25ul |
| Gene Name | FNDC3B |
| Gene Description | fibronectin type III domain containing 3B |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human, Mouse, Rat |
| Applications | WB, IHC, ICC |
| Sequence | SIPPIHVPPGYISQVIEDSTGVRRVVVTPQSPECYPPSYPSAMSPTHHLPPYLTHHPHFIHNSHTAYYPPVTGPGDMPPQFFPQHHLPHTIYGEQEIIPFYGMSTYITREDQYSK |
| Immunogen | SIPPIHVPPGYISQVIEDSTGVRRVVVTPQSPECYPPSYPSAMSPTHHLPPYLTHHPHFIHNSHTAYYPPVTGPGDMPPQFFPQHHLPHTIYGEQEIIPFYGMSTYITREDQYSK |
| Storage Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Product Group | Polyclonal Antibodies |
| Alternative Names | DKFZp762K137, FAD104, FLJ23399, PRO4979, YVTM2421 |
| Categoria | Polyclonal |
| Isoelectric Point | IgG |
| Host | RABBIT |
| UniProt ID | Q53EP0 |
| HTS Code | 3002150000 |
| Gene ID | 64778 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicación | WB, IHC, ICC |
| Conjugation | Unconjugated |
Más información
Polyclonal Antibody against Human FNDC3B, Gene description: fibronectin type III domain containing 3B, Alternative Gene Names: DKFZp762K137, FAD104, FLJ23399, PRO4979, YVTM2421, Validated applications: ICC, IHC, WB, Uniprot ID: Q53EP0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF