MRPS22,C3orf5,GIBT
  • MRPS22,C3orf5,GIBT

Anti-MRPS22 Antibody 100ul

Ref: AN-HPA007830-100ul
Anti-MRPS22

Información del producto

Polyclonal Antibody against Human MRPS22, Gene description: mitochondrial ribosomal protein S22, Alternative Gene Names: C3orf5, GIBT, GK002, MRP-S22, Validated applications: IHC, Uniprot ID: P82650, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MRPS22
Gene Description mitochondrial ribosomal protein S22
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKD
Immunogen RMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C3orf5, GIBT, GK002, MRP-S22
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P82650
HTS Code 3002150000
Gene ID 56945
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MRPS22 Antibody 100ul

Anti-MRPS22 Antibody 100ul