GALNT3,GalNAc-T3
  • GALNT3,GalNAc-T3

Anti-GALNT3 Antibody 25ul

Ref: AN-HPA007613-25ul
Anti-GALNT3

Información del producto

Polyclonal Antibody against Human GALNT3, Gene description: polypeptide N-acetylgalactosaminyltransferase 3, Alternative Gene Names: GalNAc-T3, HFTC, HHS, Validated applications: ICC, IHC, WB, Uniprot ID: Q14435, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GALNT3
Gene Description polypeptide N-acetylgalactosaminyltransferase 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence EESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHC
Immunogen EESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GalNAc-T3, HFTC, HHS
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14435
HTS Code 3002150000
Gene ID 2591
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GALNT3 Antibody 25ul

Anti-GALNT3 Antibody 25ul