MRPL2,CGI-22
  • MRPL2,CGI-22

Anti-MRPL2 Antibody 100ul

Ref: AN-HPA007455-100ul
Anti-MRPL2

Información del producto

Polyclonal Antibody against Human MRPL2, Gene description: mitochondrial ribosomal protein L2, Alternative Gene Names: CGI-22, MRP-L14, RPML14, Validated applications: IHC, WB, Uniprot ID: Q5T653, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MRPL2
Gene Description mitochondrial ribosomal protein L2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence PAPSLFPAAQMMNNGLLQQPSALMLLPCRPVLTSVALNANFVSWKSRTKYTITPVKMRKSGGRDHTGRIRVHGIGGGHKQRYRMIDFLRFRPEETKSGPFEEKVIQVRYDP
Immunogen PAPSLFPAAQMMNNGLLQQPSALMLLPCRPVLTSVALNANFVSWKSRTKYTITPVKMRKSGGRDHTGRIRVHGIGGGHKQRYRMIDFLRFRPEETKSGPFEEKVIQVRYDP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-22, MRP-L14, RPML14
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T653
HTS Code 3002150000
Gene ID 51069
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MRPL2 Antibody 100ul

Anti-MRPL2 Antibody 100ul