FAAH,FAAH-1
  • FAAH,FAAH-1

Anti-FAAH Antibody 100ul

Ref: AN-HPA007425-100ul
Anti-FAAH

Información del producto

Polyclonal Antibody against Human FAAH, Gene description: fatty acid amide hydrolase, Alternative Gene Names: FAAH-1, Validated applications: IHC, Uniprot ID: O00519, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FAAH
Gene Description fatty acid amide hydrolase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence YTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTLVPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILK
Immunogen YTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTLVPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FAAH-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00519
HTS Code 3002150000
Gene ID 2166
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FAAH Antibody 100ul

Anti-FAAH Antibody 100ul