WWTR1,DKFZp586I1419
  • WWTR1,DKFZp586I1419

Anti-WWTR1 Antibody 100ul

Ref: AN-HPA007415-100ul
Anti-WWTR1

Información del producto

Polyclonal Antibody against Human WWTR1, Gene description: WW domain containing transcription regulator 1, Alternative Gene Names: DKFZp586I1419, TAZ, Validated applications: ICC, IHC, WB, Uniprot ID: Q9GZV5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name WWTR1
Gene Description WW domain containing transcription regulator 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications ICC, IHC, WB
Sequence MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST
Immunogen MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp586I1419, TAZ
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9GZV5
HTS Code 3002150000
Gene ID 25937
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-WWTR1 Antibody 100ul

Anti-WWTR1 Antibody 100ul