RBP1,CRABP-I,CRBP
  • RBP1,CRABP-I,CRBP

Anti-RBP1 Antibody 100ul

Ref: AN-HPA007338-100ul
Anti-RBP1

Información del producto

Polyclonal Antibody against Human RBP1, Gene description: retinol binding protein 1, cellular, Alternative Gene Names: CRABP-I, CRBP, CRBP1, CRBPI, RBPC, Validated applications: ICC, IHC, WB, Uniprot ID: P09455, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RBP1
Gene Description retinol binding protein 1, cellular
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence MLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ
Immunogen MLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CRABP-I, CRBP, CRBP1, CRBPI, RBPC
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P09455
HTS Code 3002150000
Gene ID 5947
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RBP1 Antibody 100ul

Anti-RBP1 Antibody 100ul