MAP4K2,BL44,GCK
  • MAP4K2,BL44,GCK

Anti-MAP4K2 Antibody 25ul

Ref: AN-HPA007330-25ul
Anti-MAP4K2

Información del producto

Polyclonal Antibody against Human MAP4K2, Gene description: mitogen-activated protein kinase kinase kinase kinase 2, Alternative Gene Names: BL44, GCK, RAB8IP, Validated applications: ICC, IHC, Uniprot ID: Q12851, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MAP4K2
Gene Description mitogen-activated protein kinase kinase kinase kinase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence ETDPLNEPWEEEWTLLGKEELSGSLLQSVQEALEERSLTIRSASEFQELDSPDDTMGTIKRAPFLGPLPTDPPAEEPLSSPPGTLPPPPSGPNSSPLLPTAWATMKQRE
Immunogen ETDPLNEPWEEEWTLLGKEELSGSLLQSVQEALEERSLTIRSASEFQELDSPDDTMGTIKRAPFLGPLPTDPPAEEPLSSPPGTLPPPPSGPNSSPLLPTAWATMKQRE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BL44, GCK, RAB8IP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q12851
HTS Code 3002150000
Gene ID 5871
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MAP4K2 Antibody 25ul

Anti-MAP4K2 Antibody 25ul