PGBD1,dJ874C20.4
  • PGBD1,dJ874C20.4

Anti-PGBD1 Antibody 25ul

Ref: AN-HPA007267-25ul
Anti-PGBD1

Información del producto

Polyclonal Antibody against Human PGBD1, Gene description: piggyBac transposable element derived 1, Alternative Gene Names: dJ874C20.4, HUCEP-4, SCAND4, Validated applications: ICC, IHC, Uniprot ID: Q96JS3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PGBD1
Gene Description piggyBac transposable element derived 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence PCVKTYPLESGEEAVTVLENLETGSGDTGQQASVYIQGQDMHPMVAEYQGVSLECQSLQLLPGITTLKCEPPQRPQGNPQEVSGPVPHGSAHLQEKNPRDKAVVPVFNPVRSQTLVKTEEETAQAVAAEKWSHLSLTRRNLCGNS
Immunogen PCVKTYPLESGEEAVTVLENLETGSGDTGQQASVYIQGQDMHPMVAEYQGVSLECQSLQLLPGITTLKCEPPQRPQGNPQEVSGPVPHGSAHLQEKNPRDKAVVPVFNPVRSQTLVKTEEETAQAVAAEKWSHLSLTRRNLCGNS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names dJ874C20.4, HUCEP-4, SCAND4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96JS3
HTS Code 3002150000
Gene ID 84547
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PGBD1 Antibody 25ul

Anti-PGBD1 Antibody 25ul