CD81,TAPA-1,TAPA1
  • CD81,TAPA-1,TAPA1

Anti-CD81 Antibody 100ul

Ref: AN-HPA007234-100ul
Anti-CD81

Información del producto

Polyclonal Antibody against Human CD81, Gene description: CD81 molecule, Alternative Gene Names: TAPA-1, TAPA1, TSPAN28, Validated applications: ICC, IHC, Uniprot ID: P60033, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CD81
Gene Description CD81 molecule
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence VNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYL
Immunogen VNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TAPA-1, TAPA1, TSPAN28
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P60033
HTS Code 3002150000
Gene ID 975
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CD81 Antibody 100ul

Anti-CD81 Antibody 100ul