CNST,C1orf71
  • CNST,C1orf71

Anti-CNST Antibody 25ul

Ref: AN-HPA007226-25ul
Anti-CNST

Información del producto

Polyclonal Antibody against Human CNST, Gene description: consortin, connexin sorting protein, Alternative Gene Names: C1orf71, FLJ32001, PPP1R64, Validated applications: ICC, Uniprot ID: Q6PJW8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CNST
Gene Description consortin, connexin sorting protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence AVDDEEAAEVNANEQPEAPKLVLQSLFSLIRGEVEQLDSRALPLCLHQIAESYFQEEDYEKAMKFIQLERLYHEQLLANLSAIQEQWETKWKTVQPHTVTALRNSEKG
Immunogen AVDDEEAAEVNANEQPEAPKLVLQSLFSLIRGEVEQLDSRALPLCLHQIAESYFQEEDYEKAMKFIQLERLYHEQLLANLSAIQEQWETKWKTVQPHTVTALRNSEKG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf71, FLJ32001, PPP1R64
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6PJW8
HTS Code 3002150000
Gene ID 163882
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CNST Antibody 25ul

Anti-CNST Antibody 25ul