KANSL1,CENP-36
  • KANSL1,CENP-36

Anti-KANSL1 Antibody 25ul

Ref: AN-HPA007208-25ul
Anti-KANSL1

Información del producto

Polyclonal Antibody against Human KANSL1, Gene description: KAT8 regulatory NSL complex subunit 1, Alternative Gene Names: CENP-36, DKFZP727C091, KIAA1267, MSL1v1, NSL1, Validated applications: ICC, IHC, Uniprot ID: Q7Z3B3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KANSL1
Gene Description KAT8 regulatory NSL complex subunit 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LGKLQPLVASYLCSDVTSVPSKESLKLQGVFSKQTVLKSHPLLSQSYELRAELLGRQPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTKSSTHSDHDNSTSLNGGKRALTSSALHGGEMGGSESGDLK
Immunogen LGKLQPLVASYLCSDVTSVPSKESLKLQGVFSKQTVLKSHPLLSQSYELRAELLGRQPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTKSSTHSDHDNSTSLNGGKRALTSSALHGGEMGGSESGDLK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CENP-36, DKFZP727C091, KIAA1267, MSL1v1, NSL1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z3B3
HTS Code 3002150000
Gene ID 284058
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KANSL1 Antibody 25ul

Anti-KANSL1 Antibody 25ul