P4HTM,EGLN4
  • P4HTM,EGLN4

Anti-P4HTM Antibody 100ul

Ref: AN-HPA007199-100ul
Anti-P4HTM

Información del producto

Polyclonal Antibody against Human P4HTM, Gene description: prolyl 4-hydroxylase, transmembrane (endoplasmic reticulum), Alternative Gene Names: EGLN4, FLJ20262, HIFPH4, P4H-TM, PH-4, PH4, PHD4, Validated applications: IHC, WB, Uniprot ID: Q9NXG6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name P4HTM
Gene Description prolyl 4-hydroxylase, transmembrane (endoplasmic reticulum)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence KADPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESSELVRNSHHTWLYQGEGAHHIMRAIRQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRQVSPNWGLPSILRPGTP
Immunogen KADPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESSELVRNSHHTWLYQGEGAHHIMRAIRQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRQVSPNWGLPSILRPGTP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EGLN4, FLJ20262, HIFPH4, P4H-TM, PH-4, PH4, PHD4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NXG6
HTS Code 3002150000
Gene ID 54681
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-P4HTM Antibody 100ul

Anti-P4HTM Antibody 100ul