PTPRN,IA-2
  • PTPRN,IA-2

Anti-PTPRN Antibody 100ul

Ref: AN-HPA007179-100ul
Anti-PTPRN

Información del producto

Polyclonal Antibody against Human PTPRN, Gene description: protein tyrosine phosphatase, receptor type, N, Alternative Gene Names: IA-2, Validated applications: IHC, Uniprot ID: Q16849, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PTPRN
Gene Description protein tyrosine phosphatase, receptor type, N
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence HSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGA
Immunogen HSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IA-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q16849
HTS Code 3002150000
Gene ID 5798
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PTPRN Antibody 100ul

Anti-PTPRN Antibody 100ul