NFRKB,DKFZp547B2013
  • NFRKB,DKFZp547B2013

Anti-NFRKB Antibody 100ul

Ref: AN-HPA007082-100ul
Anti-NFRKB

Información del producto

Polyclonal Antibody against Human NFRKB, Gene description: nuclear factor related to kappaB binding protein, Alternative Gene Names: DKFZp547B2013, INO80G, Validated applications: ICC, IHC, Uniprot ID: Q6P4R8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NFRKB
Gene Description nuclear factor related to kappaB binding protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence SLPMLEERVLDWQSSPASSLNSWFSAAPNWAELVLPALQYLAGESRAVPSSFSPFVEFKEKTQQWKLLGQSQDNEKELAALFQLWLETKDQAFCKQENEDSSDATTPVPRVRTDYVVRPS
Immunogen SLPMLEERVLDWQSSPASSLNSWFSAAPNWAELVLPALQYLAGESRAVPSSFSPFVEFKEKTQQWKLLGQSQDNEKELAALFQLWLETKDQAFCKQENEDSSDATTPVPRVRTDYVVRPS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp547B2013, INO80G
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6P4R8
HTS Code 3002150000
Gene ID 4798
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NFRKB Antibody 100ul

Anti-NFRKB Antibody 100ul